Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0696 LSU ribosomal protein L15AB (rpl15AB) 
MVVRREKKSRKMRGSRTMGWGIRGQHRDRGSQGGRQIGMHKEKWSWLVKYGKGWYGKHGFRNPTTKLTSAISLRKLNELL
ESGYIKIKEMDGKKIVDLNELGYNKLLGGGSISIPVTIKVGKATNKAIQKVKEMGGEVILSPTE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897602 Gene name: rpl15AB COG: J COG0200 Ribosomal protein L15 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0696 hypothetical 1 rpl15AB LSU ribosomal protein L15AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0200 Translation, ribosomal structure and biogenesis Ribosomal protein L15

CROSS REFERENCES:
pI: 11,24
MW: 16196,94
GenBank: 13813865