Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0698 30S ribosomal protein S5P 
MVKMAEEVPSLNIEEWKPRTSIGSLVKEGKISSIKELFDRNLPITEPEIVDVLLPKLKYEVVDIKVVQKQTDAGEISRYK
VLVIMGNMDGYVSIGTGKAKQLRVAIQKAIRDAKMNIIPVRRGCGSWQCTCGEPHSLPFKVVGKAGSVEVDLLPAPKGTG
LVVGSVLKTLLTYAGIKDAWSTTKGETRTTENFVRAGYSALYNTYKFVTLQDWVRKR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897604 Gene name: rps5p COG: J COG0098 Ribosomal protein S5 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0698 hypothetical 1 rps5AB SSU ribosomal protein S5AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0098 Translation, ribosomal structure and biogenesis Ribosomal protein S5

CROSS REFERENCES:
pI: 10,24
MW: 24043,97
GenBank: 13813867
SCOP superfamily: => 
SCOP assignment: 134-205 7.5e-19 Ribosomal protein S5 domain 2-like
SCOP assignment: 50-123 2.6e-18 dsRNA-binding domain-like