Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0699 50S ribosomal protein L18 
MNKLANGPNYKVKPRRRREGKTNYYKRYVYVISKQTRFIVRITNKYVIVQIAKIDPKGDIMIASAHSAELAKKFGWKGDE
NNTPAAYLTGYLAGLRAIKRGVTECVADIGLHVPSKGNRVFYVIKGAIDAGLKIPIGDISIENDRIKGEHIAKYAEKLKS
ENSDLYSKLFSRYLQRGLNPENLPSHFEEILNKIKSSGG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897605 Gene name: rpl18AB COG: J COG0256 Ribosomal protein L18 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0699 hypothetical 1 rpl18AB LSU ribosomal protein L18AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0256 Translation, ribosomal structure and biogenesis Ribosomal protein L18

CROSS REFERENCES:
pI: 10,71
MW: 22401,72
GenBank: 13813868