Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0700 50S ribosomal protein L19e 
MTNLKAQKRLAASIAGVGINRIKVVEDYIEDVQSSLTRDEIRNLIKDGKIIVLKKVGISGGRLKERRKKRSLKSEGKKSG
SRKGKKGARANSKQMWVKRVRKIRAYLKWLRDHKVIDRHTYRELYLKTKGGNYKGVSDVRNVLIQMGKIKG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897606 Gene name: rpl19E COG: J COG2147 Ribosomal protein L19E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0700 hypothetical 1 rpl19E LSU ribosomal protein L19E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2147 Translation, ribosomal structure and biogenesis Ribosomal protein L19E

CROSS REFERENCES:
pI: 11,64
MW: 17286,36
GenBank: 13813869