Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0702 LSU ribosomal protein L6AB (rpl6AB) 
MQIVILREEIEIPKNVVVDLKGSIIKIKGPKGEVVKDFSFAKGIQISLDGNKIVLETTFANRRKKAVFYSIVSHIKNMIT
GVTKGYRYYLKIIYTHFPTSVKVVGNEVQITNLIGEKNTRRAQILEGVKVTVKGEDIVVEGPNLEAVAQTAANIESASKI
SGFDRRIFSDGIFIYKKEVIE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897608 Gene name: rpl6AB COG: J COG0097 Ribosomal protein L6P/L9E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0702 hypothetical 1 rpl6AB LSU ribosomal protein L6AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0097 Translation, ribosomal structure and biogenesis Ribosomal protein L6

CROSS REFERENCES:
pI: 10,39
MW: 20214,52
GenBank: 13813871
SCOP superfamily: => 
SCOP assignment: 9-85 1.6e-17 Ribosomal protein L6
SCOP assignment: 86-180 8.6e-17 Ribosomal protein L6