Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0705 30S ribosomal protein S4 
MAHITRFEAPWFLMISKKQYKWTVRPNAGPHSIEKSIPLAVVIRDYLKLAGTIREAKHIIFDGKVLVDGKVRKDYKYPVG
LMDIVSIPSADLYFRVLPDNVRFMRFSKISADEARYKYVRIINKTTIKEGRIQLNLEDGRNILVDKETAKNFKTLMTLKI
ELPSQQILDSFTISERSYAIFVGGRNVGIHGIVKNINLSKFKSRKYSVITLESRDGNTYQTNIMNVMSIGREKSDLRVD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897612 Gene name: rps4E COG: J COG1471 Ribosomal protein S4E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0705 hypothetical 1 rps4E SSU ribosomal protein S4E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG1471 Translation, ribosomal structure and biogenesis Ribosomal protein S4E

CROSS REFERENCES:
pI: 10,74
MW: 27518,88
GenBank: 13813875
SCOP superfamily: => 
SCOP assignment: 3-144 3.1e-28 Alpha-L RNA-binding motif