Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0709 30S ribosomal protein S17 
MVSKGKTVKDPGIPNITIPEKVCEDEDCPYHGSLRVRGITLEGVIVKYRGTKAAVIERQYLYYDSKYKRYERRRSRIHAH
VPPCINVREGDKVIIGECRPLSKSISFVVLGKVS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897615 Gene name: rps17AB COG: J COG0186 Ribosomal protein S17 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0709 hypothetical 1 rps17AB SSU ribosomal protein S17AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0186 Translation, ribosomal structure and biogenesis Ribosomal protein S17

CROSS REFERENCES:
pI: 10,3
MW: 12962,02
GenBank: 13813878
SCOP superfamily: => 
SCOP assignment: 37-114 6.0e-21 Nucleic acid-binding proteins