Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0718 50S ribosomal protein L4 
MYLELVKKKSDILDKDGNRIKEVELPIIFSFPVRKDLIRRVFIAEFTHSLQPKGRDPNAGKRTSAESFGINLGMARVPRV
KNSGEAALAPNTVGGRLAFPPSVNKKLAEEANVKEKRLAVISALSATADIAFVRARGHVFKDSVRFPIVVTDDIVNLKTT
SEVEEFLKKIGVYDDVERVKERIRIRAGKGKMRGRKYKEPIGPLIIVHDSNSPIIKAARNLAGVDVVNAKDVSVIHLAPG
AHPGRLTIYTESSIKILDERLSKRVVS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897622 Gene name: rpl4AE COG: J COG0088 Ribosomal protein L4 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0718 hypothetical 1 rpl4AE LSU ribosomal protein L4AE Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0088 Translation, ribosomal structure and biogenesis Ribosomal protein L4

CROSS REFERENCES:
pI: 10,84
MW: 29534,11
GenBank: 13813887