Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0719 50S ribosomal protein L3 
MGHRKLASPRRGSAGLRPRKRSSELLPTPRTWPQINSQNPKLLGFVGYKVGMTHVFMIDDWPNSPTNGKEIYMPVTVLEV
PPIIPLALRAYAIDGKGEPNVITEYWSSSSLQFLDITRRIHSISSFLKDDESKKKFDERFNTKLDLIKSNLDRIVYFRLL
VSTQPRKIPSLGKKAPDLVEIQIGGGEKKSQLDYALNILGKEITIRDVFKEGQLIDVVGVTKGKGFAGVIKRYSVVELPR
WHKHRKGSRKIGTRGPSLGTPSYTPQPGQLGFHRRTEYNKRIIKIGDEPKEINPAGGFVRYGIVRNTYVLLEGSILGSKK
RPIFLREPVRPSYVFENPPKITYVNLLSQQG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897623 Gene name: rpl3AB COG: J COG0087 Ribosomal protein L3 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0719 hypothetical 1 rpl3AB LSU ribosomal protein L3AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0087 Translation, ribosomal structure and biogenesis Ribosomal protein L3

CROSS REFERENCES:
pI: 10,97
MW: 39669,74
GenBank: 13813888