Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0729 RNA helicase (ATP dependent)/eIF4A (eiF4A) 
MVIRIYADDREKASGIPELLKELGITVIFSQLTVADYVITDDVAVERKSVNDLVNSVFDKRFFDQISRLSEVYRFPILLV
EGDINDIRKITEKWRAINNALISATIDYDVKVFYSRDKKDTAEVLKKIAEKFQFGENKSNRISLHNKAKLESVSDIQLYI
VESFPNVGSILAERLLLKFGTIQNICNASISELEKALGSRKKAEDIYKILRTHYSKTNLDNDSKKTTSLFDFL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897631 Gene name: eiF4A COG: L COG1948 ERCC4-type nuclease Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0729 hypothetical 1 RNA helicase (ATP dependent)/eIF4A Helicases 1 single function 04/22/01 00:00:00 terminal status:good L COG1948 DNA replication, recombination and repair ERCC4-type nucleases

CROSS REFERENCES:
pI: 8,36
MW: 26682,29
GenBank: 13813898
SCOP superfamily: => 
SCOP assignment: 151-215 6.1e-03 DNA repair protein Rad51, N-terminal domain
SCOP assignment: 2-112 1.1e-02 Glycosyltransferases