Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0736 exosome complex RNA-binding protein 1 
MNMSQSQKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLV
EDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIM
PVKVPRVIGKNKSMYETLTSKSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIKQFIEEKLGERNA
SSGETKTNS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897637 Gene name: - COG: J COG1097 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0736 putative 2 Conserved hypothetical protein single function 04/22/01 00:00:00 terminal status:good J COG1097 Translation, ribosomal structure and biogenesis Predicted RNA-binding proteins (S1 domain)

CROSS REFERENCES:
pI: 6,14
MW: 27997,97
GenBank: 13813904
SCOP superfamily: => 
SCOP assignment: 155-202 6.0e-03 KH-domain
SCOP assignment: 68-144 9.8e-10 Nucleic acid-binding proteins