Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0749 rRNA adenine N-6-methyltransferase (erm/ksgA) 
MDNGIRPILEIGCGKGNITRFLEPDICIELDDKMIEYLKNFNLVIADARYLPVLRGQLVSSLPYQITSDFFKEVIKLNNI
RKLTLILQKDFVDKIFNDSTYISFLLNYIYNIQIKDIIPPSCFSPRPKVYSIITIFNRIREYDKEVDSILSCISRYRNKT
LRKASKLCGFSSNNDLKVREFKPWQVLELLNSVG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897649 Gene name: erm/ksgA COG: J COG0030 Dimethyladenosine transferase (rRNA methylation) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0749 putative 2-mars erm/ksgA rRNA adenine N-6-methyltransferase Translation 1 ambiguous 2.1.1.48 Multiple homologs RNA modification 04/22/01 00:00:00 terminal status:good J COG0030 Translation, ribosomal structure and biogenesis Dimethyladenosine transferase (rRNA methylation)

CROSS REFERENCES:
pI: 9,27
MW: 22600,14
GenBank: 13813916
SCOP superfamily: => 
SCOP assignment: 8-166 6.0e-25 S-adenosyl-L-methionine-dependent methyltransferases