Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0752 50S ribosomal protein L21 
MVKHSKGYRTRSRSLLRKSPRERGAVPSLSKLMVEYKEGDNVVVKINPSVHQGMPHRRYQGKVGKIIGKRGRAYLVSVTL
GDKEKVIIVRPEHLVPFNSSG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897652 Gene name: rpl21E COG: J COG2139 Ribosomal protein L21E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0752 putative 1-fŽv rpl21E LSU ribosomal protein L21E Translation 1 ambiguous Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2139 Translation, ribosomal structure and biogenesis Ribosomal protein L21E

CROSS REFERENCES:
pI: 11,6
MW: 11377,31
GenBank: 13813919