Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0758 Peptidyl-prolyl cis-trans isomerase, FKBP-type rotamase 
MFKNNDFIYIEYTAKIKDTGEIVDTTNEEEAKKANIYDETRNYGPRLVILGENRLIKGLEEALYNFNLNEEKTIEIPPEK
AYGERDNSKIKIVPLGELRRQGITAVPNRVLRLSDGSLAVIRSVSGGRVVLDLNHPLAGRTLVYNVKVVKVLNNAKDKIM
ALIERRFSSKYANGFNVELDDGKKSVRITIPKDLYLVEDLQINVYSLAYEIVNYVLADYTVEVLQQYNKSTFSSS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897659 Gene name: - COG: O COG1047 FKBP-type peptidyl-prolyl cis-trans isomerases 2 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0758 hypothetical 1 Peptidyl-prolyl cis-trans isomerase, FKBP-type rotamase Translation 1 single function 5.2.1.8 Protein modification 04/22/01 00:00:00 terminal status:good O COG1047 Posttranslational modification, protein turnover, chaperones FKBP-type peptidyl-prolyl cis-trans isomerases 2

CROSS REFERENCES:
pI: 7,52
MW: 26716,27
GenBank: 13813928
SCOP superfamily: => 
SCOP assignment: 1-151 4.7e-19 FKBP-like