Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0777 DNA repair protein radA homolog (radA-like) 
MNLSTFVFERGNLVSIYGESGVGKTSLSLELALEIRTSVFISTEGSLFEARLEKIKVGQGVYFASVKSNIELFNGIINSL
EYKPSLIVVDTINTFYRYERNVHSFLKLLIILRSIAQSNVKILLVWEVSANNKVAGEKFMRKFSDDVLRITKSYIIGNLR
RCKFKITERGVIGCL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897679 Gene name: radA-like COG: O COG1066 Predicted ATP-dependent serine protease Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0777 hypothetical 1 radA-like DNA repair protein radA homolog Replication and Repair 1 single function Bacterial RadA-like (related to bacterial sequences) 04/22/01 00:00:00 terminal status:suspect: Pn L COG0468 DNA replication, recombination and repair RecA/RadA recombinase

CROSS REFERENCES:
pI: 10,38
MW: 19797,96
GenBank: 13813952
SCOP superfamily: => 
SCOP assignment: 5-173 2.1e-12 P-loop containing nucleotide triphosphate hydrolases