Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0832 dTDP-4-dehydrorhamnose reductase (rfbD-1) 
MEDFIIKTRPDVIINTAAMTDVDKCEVEREKAYKINAEAVKHMVRASRVVEAYFIHVSTDYVFDGTKGNYKEDDLPNPIN
YYGLTKLLGETFALSYDDSLVIRTSGVFRHKGFPVYVYKTLKEGKTVFAYKGYYSPISARKLASAIEELLALRKTGLLNV
AGERISRYELALKIKEKFNLPGEVKEVDEVKGWTARRPFDSSLDYSKAKKILSVDFYSLDLEGMVL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897732 Gene name: rfbD-1 COG: M COG1091 dTDP-4-dehydrorhamnose reductase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0832 hypothetical 1 rfbD-1 dTDP-4-dehydrorhamnose reductase Cell Envelope 1 single function 1.1.1.133 Surface polysaccharides and lipopolysaccharides 04/22/01 00:00:00 terminal status:good M COG1091 Cell envelope biogenesis, outer membrane dTDP-4-dehydrorhamnose reductase

CROSS REFERENCES:
pI: 8,95
MW: 25726,36
GenBank: 13814013
SCOP superfamily: => 
SCOP assignment: 1-225 2.1e-31 NAD(P)-binding Rossmann-fold domains