Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0833 dTDP-4-dehydrorhamnose 3,5 epimerase (rfbC-1) 
MPFDFEDLGMGVLLIKPKVFPDKRGFFLELFKATDFSKHNIPMPVQVNMSFSVRGVVRGLHYQITPKEQGKLVFVPKGKI
LDVAVDVRKSSPTFGKYTSAELSESNHHMLWIPPGFAHGFQALDDSLVVYFVTHNDYSPQHERCINYSYIEWPIKEIIVS
DKDKQCPPLDKAEVFS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897733 Gene name: rfbC-1 COG: M COG1898 dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0833 hypothetical 1 rfbC-1 dTDP-4-dehydrorhamnose 3,5 epimerase Cell Envelope 1 single function 5.1.3.13 Surface polysaccharides and lipopolysaccharides 04/22/01 00:00:00 terminal status:good M COG1898 Cell envelope biogenesis, outer membrane dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes

CROSS REFERENCES:
pI: 7,2
MW: 20120,12
GenBank: 13814014
SCOP superfamily: => 
SCOP assignment: 11-176 2.5e-56 RmlC-like