Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0894 anthranilate synthase component II 
MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRIIISPGPGTPEKREDIGVSLDVIKYLGKRTPI
LGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIM
AIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897781 Gene name: trpGD COG: EH COG0512 Anthranilate/para-aminobenzoate synthases component II Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0894 confirmed 1 trpGD Anthranilate synthase component II Amino Acid Biosynthesis 1 single function 4.1.3.27 Aromatic amino acids 04/22/01 00:00:00 terminal status:good E COG0512 Amino acid transport and metabolism Anthranilate/para-aminobenzoate synthases component I

CROSS REFERENCES:
pI: 6,89
MW: 21909,05
GenBank: 13814072
SCOP superfamily: => 
SCOP assignment: 1-195 6.4e-59 Class I glutamine amidotransferases (GAT)