Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0922 hypothetical protein SSO0922 
MPAYKDLYDMVKSMIEKEINRMEKEFRRIESEIKEEIEKYNVPLYTFYESEDFYYYLIDVPNVDTSTLYVKVKNDSLRIS
CKDKSNKEYVLNIKVPEDADIDSLSVTRVKWLVKITVKRRKD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897809 Gene name: - COG: O COG0071 Molecular chaperone (small heat shock protein) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0922 hypothetical 1 Hypothetical protein 1 putative Similar to the heat shock proteins of Thermotoga maritima (strain MSB8) and Arabidopsis thaliana 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 5,49
MW: 14724,79
GenBank: 13814104
SCOP superfamily: => 
SCOP assignment: 43-119 4.6e-07 HSP20-like chaperones