Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0925 ABC transporter 
MVTLKIEDLHVEVEGKEILRGINLEVRSGEIHALMGPNGSGKTSLSLAIMGHPKYKITKGRIVLDGEDITNLEPHEKAKK
GIFLAFQNPIEIAGVRLSTLLVAEYNKVSDSSASVMEVISKVKNISKEVGIADSLLNRGVFEGFSWRRKEESRDLTNASI
KA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897811 Gene name: - COG: O COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0925 hypothetical 1 ABC transporter Transport 1 single function 04/22/01 00:00:00 terminal status:check: MH R COG0396 General function prediction only Iron-regulated ABC transporter ATPase subunit SufC

CROSS REFERENCES:
pI: 9,01
MW: 17769,37
GenBank: 13814106
SCOP superfamily: => 
SCOP assignment: 4-142 1.4e-23 P-loop containing nucleotide triphosphate hydrolases