Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0967 putative deoxyhypusine synthase 
MINREDLLKNPVEDITLSDLKKYNDIVSVFDKIYGFSSEGIVNGSKILKEMIKNADLRFLSFTANLVSTGLRGLFADLIK
KGYFNIVVTTGGTIDHDLARSFGGVYYKGSFDIDDTMLKDLEIHRLGNVLVPFESYGKVIEDVVRKFLPEITKDRKEISA
YELLWEFGKRITDSNSILRAAYDKNVPIIVPGILDGSFGTNLFIQSQFLNFRINLFEDMRLIKDLIFSSKKSGALIIGGG
ISKHHTIWWNQFKDGLNYAIYITTAQEYDGSLSGAKPREAISWNKIRPDAKHVTIYGDATIIVPILAASLLS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897846 Gene name: - COG: O COG1899 Deoxyhypusine synthase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0967 hypothetical 1 Deoxyhypusine synthase Uncategorized 1 single function 1.1.1.249 04/22/01 00:00:00 terminal status:good J COG1899 Translation, ribosomal structure and biogenesis Deoxyhypusine synthase

CROSS REFERENCES:
pI: 7,87
MW: 35049,99
GenBank: 13814149
SCOP superfamily: => 
SCOP assignment: 11-312 1.2e-87 DHS-like NAD/FAD-binding domain