Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0970 translation initiation factor IF-5A 
MSITYTTVGELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIAD
MGNKIQVMDLESYETFEIEKPTEDELASKIKPNAELEYWEIMGRRKIVRVK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897849 Gene name: eiF5A COG: J COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0970 hypothetical 1 eiF5A Initiation factor 5A, hypothetical Translation 1 single function Translation factors 04/22/01 00:00:00 terminal status:good J COG0231 Translation, ribosomal structure and biogenesis Translation elongation factor P/translation initiation factor eIF5-a

CROSS REFERENCES:
pI: 6,55
MW: 14491,8
GenBank: 13814154
SCOP superfamily: => 
SCOP assignment: 69-131 6.5e-24 Nucleic acid-binding proteins
SCOP assignment: 1-69 2.3e-22 Translation proteins SH3-like domain