Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0975 3-oxoacyl-(acyl carrier protein) reductase (fabG-1) 
MNINISGKRVLVTASTEGIGRGIAEAFLREGCNVVISSRNKDKIEKAILEMRKIGPSVWGFPADLTDFKSLEELVGYALK
IMNGIDILVVNSGNPPKEPSYFFENTMEDWEYATKLYLLSAIKLTNLVYQYMKAQRWGRIFFLSSWTIKEPQRIFSLADI
TRAPLIQMAKLLSKELGEYNVNVNVILMGSFETEGAKRSLKKYAEKVGQPLDVIWKREVISQIPIGRTGDIKNELGSLLV
FLSSDYAGYINGTSILIDGGMSRAI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897853 Gene name: fabG-1 COG: IQR COG1028 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0975 hypothetical 1 fabG-1 3-oxoacyl-(acyl carrier protein) reductase Lipid metabolism 1 single function 1.1.1.100 04/22/01 00:00:00 terminal status:good R COG1028 General function prediction only Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

CROSS REFERENCES:
pI: 9,71
MW: 29673,21
GenBank: 13814158
SCOP superfamily: => 
SCOP assignment: 1-262 1.3e-59 NAD(P)-binding Rossmann-fold domains