Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0981 Pyruvate kinase (pyK) 
MRKTKIVATLGPSSEEKVKELAEYVDVFRINFAHGDETSHRKYFDLIRTYAPESSIIVDLPGPKLRLGELKEPIEVKKGD
KIVFSQKDGIPVDDELFYSAVKENSDILIADGTIRVRVKSKAKDRVEGTVIEGGILLSRKGINIPNVNLKSGITDNDLKL
LKRALDLGADYIGLSFVISENDVKKVKEFVGDEAWVIAKIEKSEALKNLTNIVNESDGIMVARGDLGVETGLENLPLIQR
RIVRTSRVFGKPVILATQVLTSMINSPIPTRAEIIDISNSIMQGVDSIMLSDETAIGNYPVESVRTLHNIISNVEKSVKH
RPIGPLNSESDAIALAAVNASKVSKADVIVVYSRSGNSILRVSRLRPERNIIGVSPDPRLAKKFKLCYGVIPISINKKMQ
SIDEIIDVSAKLMQEKIKDLKFKKIVIVGGDPKQEAGKTNFVIVKTLEQQKK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897860 Gene name: pyK COG: G COG0469 Pyruvate kinase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0981 hypothetical 1 pyK Pyruvate kinase Energy Metabolism 1 single function 2.7.1.40 Glycolysis 04/22/01 00:00:00 terminal status:good G COG0469 Carbohydrate transport and metabolism Pyruvate kinase

CROSS REFERENCES:
pI: 10,05
MW: 49883,47
GenBank: 13814165
SCOP superfamily: => 
SCOP assignment: 63-151 1.4e-15 Pyruvate kinase beta-barrel domain
SCOP assignment: 1-323 4.4e-73 Phosphoenolpyruvate/pyruvate domain
SCOP assignment: 298-448 1.5e-27 Pyruvate kinase, C-terminal domain