Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1000 Maltose transport inner membrane protein 
MNKVKLTFFLLVLPALAYVISFAFFPTIEAVYLSFQDPHGGFSLYNYKELSYFNLSSAIINTIVVTIGALAIQLALGFLV
ASVLSREFFGKRALSTITIIPMGIATVVAAVTFSFVFQTSGGYANTILHSLFGLNVNWYQSSISSLLVVMIADSWKNTPI
VALILLAGMSSIPKELYYASAIDGAGPIRRFFYITLPNLRSFIGISLILRGVQEFNIFALPLILIGEHPPLLTTLIYDLY
TTTFPEVGLALASATILLGFILVFSGIVIKLSGGR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897876 Gene name: - COG: G COG1175 ABC-type sugar transport systems, permease components Taxon: 273057 Lineage: Archaea: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1000 hypothetical 1 Maltose transport inner membrane protein Transport 25 single function Cell membrane transport 04/22/01 00:00:00 terminal status:good G COG1175 Carbohydrate transport and metabolism ABC-type sugar transport systems, permease components

CROSS REFERENCES:
pI: 9,96
MW: 29945,08
GenBank: 13814185