Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1005 hypothetical protein SSO1005 
MILKTLLEVIDILESKDPLQKIRERLESKVKYEEIKAGEVTFIKALYEGVGNNKVEILGRLGAIQMVGVNKGLVSDADGA
IISLAVLLELLNLRDKGIELNLDVLFVTNLSIKAKLIPHKPFDFMVPLVGLDEALKVEVEPSASLVISIDSTKGNRIVKF
DDFAITHVVKDGYILKLHDNVIDIYNKITGHEIYMVPLTTGDLTPLDYNVSHISTLISPWLYTDSPVIGIATVSKQVIPG
YETGVLNIEMLEHASRFCIELLKYIENGGKVYEEKELEELENRLGKSSLLKAKRR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897880 Gene name: - COG: J COG1534 Predicted RNA-binding protein containing KH domain, possibly ribosomal protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1005 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 5,37
MW: 32909,12
GenBank: 13814189