Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO10051 hypothetical protein SSO10051 
MYSQEIKDLIKKTRAERADIRIGKYGVTEGMINEIKRRLNEHKVVKVKIGIKEIDDRKEFAKRVAEMVGAKLIEVRGYTF
ILAKIDSDR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898999 Gene name: - COG: J COG1534 Predicted RNA-binding protein containing KH domain, possibly ribosomal protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO10051 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with APE1091, PH1323, PAB1812, AF2070 04/22/01 00:00:00 terminal status:suspect: LH R COG1534 General function prediction only Predicted RNA-binding protein containing KH domain

CROSS REFERENCES:
pI: 10,59
MW: 10364,12
GenBank: 13815524