Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1019 Thiosulfate sulfurtransferase (cysA-1) 
MFFHIMLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVL
YSEMNNRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGIVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLI
DSRSKEEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVYCRTGARASVAW
YALKEVLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897887 Gene name: cysA-1 COG: P COG2897 Rhodanese-related sulfurtransferase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1019 hypothetical 1 cysA-1 Thiosulfate sulfurtransferase Central Intermediary Metabolism 16 single function 2.8.1.1 Sulfur 04/22/01 00:00:00 terminal status:good P COG0607 Inorganic ion transport and metabolism Rhodanese-related sulfurtransferases

CROSS REFERENCES:
pI: 6,39
MW: 32079,46
GenBank: 13814200
SCOP superfamily: => 
SCOP assignment: 4-124 1.3e-30 Rhodanese/Cell cycle control phosphatase
SCOP assignment: 149-275 9.9e-31 Rhodanese/Cell cycle control phosphatase