Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1034 ABC transporter, ATP binding protein. 
MSEIVKVDVFKKFKNFELKVNFSVNEGEKVLIQGPNGSGKTTLLYLIYGVLNPDSGYVRVFNKNPTVELRKSEMYMLEEY
LIFLENASLKENLEFITSLRDFNINKTEELINKFDLPLYKKSYQLSSGQRRLFKLALAFSAEAKLLLLDEPTSNLDIENS
KAVKDMIREYSGTIIFASHDLLLKESCDKTIYLRTGKIERIEIK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897902 Gene name: - COG: V COG1136 ABC-type antimicrobial peptide transport system, ATPase component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1034 hypothetical 2 ABC transporter, ATP binding protein. Transport 52 single function 04/22/01 00:00:00 terminal status:check: MH R COG1136 General function prediction only ABC-type (unclassified) transport system, ATPase component

CROSS REFERENCES:
pI: 8,35
MW: 23556,06
GenBank: 13814217
SCOP superfamily: => 
SCOP assignment: 19-198 8.0e-41 P-loop containing nucleotide triphosphate hydrolases