Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO10802 Carbon monoxide dehydrogenase, small chain. Carboxy-end fragment (cutC-2) 
MISSTPTNVTVKSISNLLFRRIWIFFQQEICLHYHSRRTETTLKGEIFLKRLLNWMKLRIY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899364 Gene name: cutC-2 COG: Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO10802 hypothetical 1 cutC-2 Carbon monoxide dehydrogenase, small chain. Carboxy-end fragment Energy Metabolism 1 single function 1.2.99.2 Possible frameshift with SSO2637. This gene is uncertain 04/22/01 00:00:00 terminal status:suspect: Pn C COG2080 Energy production and conversion Predicted aldehyde dehydrogenases

CROSS REFERENCES:
pI: 8,09
MW: 5721,54
GenBank: 13815950