Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO11231 Ferredoxin like protein (zfx-like2) 
MRIEEKLYTLRYKKDEQPHLAIIDPNKCLRCEQVNGVPQPCIAVCPANVYSWIDQRIVISYENCVECGACRIACPYSNIL
WKYPRYGLGIALRYG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899535 Gene name: zfx-like2 COG: C COG2440 Ferredoxin-like protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO11231 hypothetical 1 Ferredoxin like protein Energy Metabolism 1 single function Electron transport 04/22/01 00:00:00 terminal status:good C COG1142 Energy production and conversion Fe-S-cluster-containing hydrogenase components 2

CROSS REFERENCES:
pI: 8,03
MW: 10998,75
GenBank: 13816172
SCOP superfamily: => 
SCOP assignment: 21-83 1.8e-11 4Fe-4S ferredoxins