Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO11281 Last part of transposase in ISC1250 
MCTMLDFFTERFYTGSSQLPRNFGSESNNLIESFNSLLERRFGKFHSPWRMLQIARTIANNYNLLTYFLIIVIILHCTYS
SRFIRNIHNNFFIELS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899559 Gene name: - COG: L COG3328 Transposase and inactivated derivatives Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO11281 hypothetical 1 last part of transposase in ISC1250 1 single function ISC1250 is disrupted by ISC1190 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 7,44
MW: 50699,63
GenBank: 13816202