Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO11412 Copper binding protein 
MAKIRKLEVEVRNMCCGHCATNVSKSVKEISGVREVDVDLREGLAFISIDEKADMNRVINNIREKITDLGYMVGEIKIIG
GV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899610 Gene name: - COG: P COG2608 Copper chaperone Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO11412 hypothetical 1 Copper binding protein Transcription 1 single function Putative transcription activator RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:suspect: LH P COG2217 Inorganic ion transport and metabolism Cation transport ATPases

CROSS REFERENCES:
pI: 8,42
MW: 9837,23
GenBank: 13816265
SCOP superfamily: => 
SCOP assignment: 3-64 6.0e-09 Metal-binding domain