Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO11972 hypothetical protein SSO11972 
MIDNPTDIIIILVVIAVLFFGSSKMPELFRALGRSMGEFKKGQLEAEMEMQQMMSSNVVEKGERSESVEELEKKIVELQK
QLEALKQSKKA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899815 Gene name: - COG: U COG1826 Sec-independent protein secretion pathway components Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO11972 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:suspect: LH N COG1826 Cell motility and secretion Component of Sec-independent protein secretion pathway TatA (homolog of Tha4/Hcf106)

CROSS REFERENCES:
pI: 5,04
MW: 10318,08
GenBank: 13816527