Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO12093 hypothetical protein SSO12093 
MQAELKIPEDIWPRRRDWGGEIVSLYIKEGSEIKVGDVIAEVEIEKAILKILSQYNGKVIKVLVREGDKVSPGSVIALIE
V

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899863 Gene name: - COG: C COG0508 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO12093 hypothetical 1 Hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:suspect: Pn C COG0508 Energy production and conversion Dihydrolipoamide acyltransferases

CROSS REFERENCES:
pI: 4,96
MW: 9058,54
GenBank: 13816587
SCOP superfamily: => 
SCOP assignment: 20-80 1.4e-15 Single hybrid motif