Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO12256 Glycosyltransferase, putative 
MIVPVKNEERVLPRLLDRLVNLEYDKSKYEIIVVEDGSTDRTFQICKEYEIKYNNLIRCYSLPRANVPNGKSRALNFALR
ISKGEIIGIFDGDTVPRLDILEYVEPKFEDITVGAVQGKLVPINVRESVTSRLAAIEELIYEYSIAGRAKVGLFVPIEGT
CSFIRKSIIMELGGWNEYSLTEDLDISLKIVNKGCKIVYSPTTISWREVPVSLRVLIRQRLRWYRGHLEVQLGKLRKIDL
RIIDGILIVLTPFFMVLNLVNYSLVLVYSSSLYIVAASLVSLASLLSLLLIILIARRHMIEYFYMIPSFVYMNFIVALNF
TAIFLELIRAPRVWVKTERSAKVTGEVMG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15896972 Gene name: - COG: M COG1215 Glycosyltransferases, probably involved in cell wall biogenesis Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO12256 hypothetical 1 Glycosyltransferase, putative Cell Envelope 1 single function Similar to cellulose synthase homologs ydaM and icaA, probably involved in cell wall biogenesis or intercellular adhesion Surface polysaccharides and lipopolysaccharides 04/22/01 00:00:00 terminal status:good M COG1215 Cell envelope biogenesis, outer membrane Glycosyltransferases, probably involved in cell wall biogenesis

CROSS REFERENCES:
pI: 9,69
MW: 39921,7
GenBank: 13816692
SCOP superfamily: => 
SCOP assignment: 2-232 7.9e-46 Nucleotide-diphospho-sugar transferases