Sulfolobus solfataricus P2 >SSO1230 Toluene-4-monooxygenase system protein C. (tmoC) MNYPGEFHKLLTLDDIYEGEAKLVEVNRYEILVVNIKGEIKAYYARCAHALGLIESNSFDGEEKIICPVHLWEYNARTGE SINPVGSSLFPLDVKVEGSDIFVKVPSVPISEFKVKWFGMYRQRGVINEFGVNS15898081 Gene name: tmoC COG: PR COG2146 Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2 __________
|
|
CROSS REFERENCES: pI: 5,09 MW: 15188,27 GenBank: 13814428 SCOP superfamily: => SCOP assignment: 3-103 1.3e-12 ISP domain