Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1255 Transcriptional regulator 
MSLSQIAYEKILEYIITGKYKPGNTLKEEELASLLKISRTPIREALARLEKEGVIVKNGKSFTVIPLTESDILQLYEVRI
NLESLSAKLAAIRASQDEINKIINVLNEIRGSANADPLTLANLNGNLHRAIAEASHNKYIVDILDSIRLKLKIVRITLFT
SFQRRDEEFREHESIVIAIKNRSPDLAYDMMRMHEEKVLDYVKQNILPVMFR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898099 Gene name: - COG: K COG1802 Transcriptional regulators Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1255 hypothetical 2 Transcriptional regulator Transcription 1 single function Hits to hypothetical transcriptional regulators RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1802 Transcription Transcriptional regulators, GntR family

CROSS REFERENCES:
pI: 9,53
MW: 24274,93
GenBank: 13814448
SCOP superfamily: => 
SCOP assignment: 10-57 7.4e-04 "Winged helix" DNA-binding domain