Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1281 Oligo/dipeptide transport, ATP binding protein . amino-end fragment. (dppF-2) 
MDNNEIIVKVQNVWIKYPMGRVGLFRKLYVHAVNDVSLEIKKGEIFGLIGESGSGKTTLGKGILRLIETYSGSIYWKVDG
GKLVDITKLNDNTLRRLRKDFQIIQQDPYGALDPRMSVYEILAEGLRLHKLISNKSEEVEQIYKILSIVKLTPPENFANK
KPMELSGGQRQRVVVARALLLRPKFIVADEPISMLDASTRGQILEFILNDRDQRGTAYLFITHDISIASYVSDRIGSGVS
PNYFI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898123 Gene name: dppF-2 COG: E COG4608 ABC-type oligopeptide transport system, ATPase component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1281 hypothetical 1 dppF-2 Oligo/dipeptide transport, ATP binding protein . amino-end fragment. Transport 1 single function Interrupted by transposase in orf SSO1280 Cell membrane transport 04/22/01 00:00:00 terminal status:check: MH E COG1124 Amino acid transport and metabolism ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component

CROSS REFERENCES:
pI: 10,17
MW: 27684,88
GenBank: 13814478
SCOP superfamily: => 
SCOP assignment: 6-235 8.6e-52 P-loop containing nucleotide triphosphate hydrolases