Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1309 hypothetical protein SSO1309 
MDYKVEYISIYEYEADVISNENTLKIVPYNGDNQVLISHEVGTIPNGYKTSYVDIFGNIVYKIKVQELHRRLEIYSKSVV
TLDKKVIKTDYEFPYNYGFNEFLLPTRLVDPEQFQKIAKELTKSLKTLGEVIETIVNFVRKKIIYKPGITNINTTAFEAY
SLGYGVCQDYTHITLGLLRALGIPARYVMGVVNDNPRATHAWVEVLTPDGTYIDVDPTRGRFYNLDYIKFAVGRDFNDVS
PVIGFFVSSGRGWLKEVRIKVEKSAS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898150 Gene name: - COG: E COG1305 Transglutaminase-like enzymes, putative cysteine proteases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1309 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with bacterial proteins from D. radiodurans and M. tuberculosis 04/22/01 00:00:00 terminal status:good E COG1305 Amino acid transport and metabolism Transglutaminase-like enzymes, putative cysteine proteases

CROSS REFERENCES:
pI: 7,61
MW: 30444,67
GenBank: 13814511
SCOP superfamily: => 
SCOP assignment: 136-255 2.2e-20 Cysteine proteinases