Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1456 hypothetical protein SSO1456 
MRLEIAEKYMAEAYEYLKKGDTIQASGKAYKVAEEIVKAIKFLISKLIGQDVGVISPYRTQVRKLDQELANYKPYVEVNT
VDAFQGREKDVIIFSVTATNGLRFVTNRRRLNVAFTRPRYKLIVLGNENSIMSCQMTIC

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898288 Gene name: - COG: L COG1112 Superfamily I DNA and RNA helicases and helicase subunits Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1456 hypothetical 1 Hypothetical protein 1 single function Similarity with carboxy-end of some DNA helicases 04/22/01 00:00:00 terminal status:good L COG1112 DNA replication, recombination and repair Superfamily I DNA helicases and helicase subunits

CROSS REFERENCES:
pI: 10,25
MW: 15906,42
GenBank: 13814681
SCOP superfamily: => 
SCOP assignment: 29-124 3.4e-21 P-loop containing nucleotide triphosphate hydrolases