Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1468 hypothetical protein SSO1468 
MYIEEIKRVLSDQRDVLEEKMSRKLVERDVPNLLKYLEVPNALAILGVRRSGKSTLSLLLLKRKKFAYVNFDDERFYNLN
IGDLNKVLQAIYELYGVDVDYIVLDEIHNVKGWELFVSRLRDVKKLIITGSNSKMLSGELATYLTGRHSDYILFPFSFQE
YLKYKEVKVEYFSTRVISTLKNELEKYTEVGGFPEALMLGKEQVNVIYNDILFKDIVSRYKIREIEKFREFARTVISYYS
NEISLSSIAKILGLNKRTVEKWASGLREAYLTFFIPRYGEKLKQRLTYNKKVYVVDVGIVSNLAIKGKDKGRIIENLVAI
KLLRELQGEEKLYYMRNNYEVDFYDEKNSRLIQVTYTSDKIENREIRGLIEGYRLTKAKKLLIITWDLEEKIQVEGVNIE
VLPLYRFLLE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898300 Gene name: - COG: R COG1373 Predicted ATPase (AAA+ superfamily) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1468 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with MJ1544, PH0691, PAB1420 and HI1038 from H. influenzae 04/22/01 00:00:00 terminal status:good R COG1373 General function prediction only Uncharacterized ATPases of the AAA superfamily

CROSS REFERENCES:
pI: 9,97
MW: 48255,66
GenBank: 13814695
SCOP superfamily: => 
SCOP assignment: 10-346 5.5e-05 P-loop containing nucleotide triphosphate hydrolases