Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1545 hypothetical protein SSO1545 
MLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLEL
QKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNWNRKDRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPAL
AYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGG
IPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEIS
DSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898368 Gene name: - COG: R COG1672 Predicted ATPase (AAA+ superfamily) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1545 hypothetical 1 Conserved hypothetical protein 1 single function Possibly an ATPase of the AAA superfamily (COG1672, predicted). Similar to SSO2139,SSO2730,SSO2101,SSO1939,SSO1196,SSO1330/SSO3257 04/22/01 00:00:00 terminal status:good R COG1672 General function prediction only Predicted ATPases of the AAA superfamily

CROSS REFERENCES:
pI: 8,54
MW: 41711,87
GenBank: 13814777
SCOP superfamily: => 
SCOP assignment: 7-261 1.0e-12 P-loop containing nucleotide triphosphate hydrolases