Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1614 Glycosyltransferase, putative 
MPCLLLKGDIIESKTGTVRWALEVQKAIPDLSLFYFGKSNSLQKNQYLIKIAKIGSIYIILPTFSNLRNIAKLLKCNSVY
FVDIPSLPFFLLIYFILKLFGRKIIFGLHGFIQRDNGIKGKIFRNVAKHETVHVLNVYDKNLMEKIGCKRIFLIPNFIYS
NSSEIIRCNKFIVLFVGRLDINHKGIDLLVDIILKLKTNIEFHIIGNGEGKNVIEELAKKQTNVKYLGEVNDEVLSQEYA
RASLFILTSRYETFGYVLLEAQSHGLPIVAFDLPEIRDNIILGKLVRPFNTEDFARAILDFYNQYKLNKEKYYLIREEIR
RKAYDIFNKQKIIDNILKLFL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898434 Gene name: - COG: M COG0438 Glycosyltransferase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1614 hypothetical 1 Glycosyltransferase, putative Cell Envelope 1 hypothetical Surface polysaccharides and lipopolysaccharides 04/22/01 00:00:00 terminal status:good M COG0438 Cell envelope biogenesis, outer membrane Glycosyltransferases I

CROSS REFERENCES:
pI: 10,25
MW: 39598,31
GenBank: 13814855
SCOP superfamily: => 
SCOP assignment: 2-315 9.0e-03 alpha/beta-Hydrolases