Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1624 Polysaccharide biosynthesis related protein 
MNPIKNTLKSLSVTTTNVIVALIFFIITAKITNPEFFGKVAIIQLLEVVTSAFFYFIPGQIITREISYLYARKEISKSVI
GKFLSFPFLVLPLFLILLLFPNYVKLTIPYLFLYLLNGVMGSIMVGMDMFTETAITGNIFLIIRWGISIIAVLSHNIYLF
IEIWTLGGIISVSMNYAFLSRKVGLILPSFDFAFLFKHFKEGLPLYLSSSATFLSSQGDRVTTAYLLGSYYLGLYQFSAL
VAGVPSMVLGALGGVLLPTASFYKALGKDEKKMSSISFRVLSLITFLAVIISIPTAVLVVEKFFPAYISGIKVLILLLLA
TTLPFPIGSLTNFIIAAKKSLRPFLILSLLNGGLVLLTSFLLIPRIGIIGGAISQAIVSTISSSFVLVYALKEDTFVLGK
RESAILFMMPLIAFYEVFVDPPYLDFLLLLSVILLFKTFRIITAEDMKLIDSFLPSKLKFIISLMKAIS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898444 Gene name: - COG: R COG2244 Membrane protein involved in the export of O-antigen and teichoic acid Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1624 hypothetical 1 Polysaccharide biosynthesis related protein Cell Envelope 1 single function Surface polysaccharides and lipopolysaccharides 04/22/01 00:00:00 terminal status:suspect: LH R COG0728 General function prediction only Uncharacterized membrane protein, putative virulence factor MviN

CROSS REFERENCES:
pI: 10,47
MW: 51929,04
GenBank: 13814867