Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1655 Helicase of the snf2/rad54 family (carboxy end fragment), hypothetical 
MRTLPDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATDRVYRIGQTRNVIVHKLISVGTLE
EKIDQLLAFKRSLFKDIISSGDSWITELSTEELRKVIELSVGGY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898473 Gene name: - COG: KL COG0553 Superfamily II DNA/RNA helicases, SNF2 family Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1655 hypothetical 1 Helicase of the snf2/rad54 family (carboxy end fragment), hypothetical Replication and Repair 1 single function MG018/MG017/MG016 HOMOLOG. Protein is interrupted by orf SSO1654 encoded transposase Helicases 04/22/01 00:00:00 terminal status:good K COG0553 Transcription Superfamily II DNA/RNA helicases, SNF2 family

CROSS REFERENCES:
pI: 9,14
MW: 14063
GenBank: 13814902
SCOP superfamily: => 
SCOP assignment: 6-100 1.1e-13 P-loop containing nucleotide triphosphate hydrolases