Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1751 Second ORF in transposon ISC1395 
MFFTDESGIHHDPSKVRRLGLYNVPVDYPSRKLNVLASIPLFDGVPCFMFTYSNVNSEIFAEFLRLFRNSGPIVLILDNA
KFHKNAYVFSVASQLGITLLFLPPYSPDLNPIELVWKDLKRWVNTYYNLEYTLDSMEEEFYYLFLRECSQTVMKFKKRL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898552 Gene name: - COG: L COG3335 Transposase and inactivated derivatives Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1751 hypothetical 1 second ORF in transposon ISC1395 1 single function ISC1395 (sso1748 and sso1751) is disrupted by ISC1078 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 7,44
MW: 18729,51
GenBank: 13814995
SCOP superfamily: => 
SCOP assignment: 28-142 5.5e-08 Ribonuclease H-like