Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1788 hypothetical protein SSO1788 
MVIEKCKEKKEFNNDYYQYFLNNVKIEGKEIKINEKLYPDRAWVDVICDYVCSKVKDNTKEEIEEFGKILEKFSMNAGPL
ISREINIIYNLAKDLKEGERKQYSEIYSEDEEGRSKQLSEEELKRNFIAHAGLLKEYVIIEKKNGKIYVNYDESKIKELL
EWSVLKQS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898587 Gene name: - COG: L COG1517 Uncharacterized protein predicted to be involved in DNA repair Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1788 hypothetical 1 Hypothetical protein 1 single function Similarity with MJ1666. Probable frameshift at amino end with SSO1787 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 5,2
MW: 19982,66
GenBank: 13815036