Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1808 hypothetical protein SSO1808 
MTNKAIKATNEELQQVYNDIPKAYDRANRFISFNQDVKWRADLVKTILKYCKRPKLILDVASGKGELSYTFKKIYKDNSN
YEIILSDYAENMLKMALIKDDKVLCSFDALPFREKTFDIVMSSFALHASDNIEDVIREITRVSRKIVGFIAMGKPDSWVR
RIYLSIYLKYIMPYIAVLGGAKARDFKYIYYIYERVPTNSQHKRIFEKYIDIKVYEERALNLFYFVVGFPKE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898609 Gene name: - COG: H COG2226 Methylase involved in ubiquinone/menaquinone biosynthesis Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1808 hypothetical 1 Ubiquinone/menaquinone biosynthesis methyltransferase Cofactor Biosynthesis 1 single function 2.1.1.- Quinones 04/22/01 00:00:00 terminal status:good H COG2226 Coenzyme metabolism Methylase involved in ubiquinone/menaquinone biosynthesis UbiE/COQ5

CROSS REFERENCES:
pI: 10,14
MW: 27369,6
GenBank: 13815062
SCOP superfamily: => 
SCOP assignment: 1-209 2.2e-17 S-adenosyl-L-methionine-dependent methyltransferases