Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1834 hypothetical protein SSO1834 
MVSRYYDWLRQAERNLKSAELNFENGIYEETCYEAQQVAEKSVKSLLSYFHKEMRGHSITFLLQFSSISIPDWILKCAQE
LDKNYIPSRYPDVYDQGAPLDYYSKDDATSCLECARKILAWVKEIVGTSM

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898635 Gene name: - COG: S COG2250 Uncharacterized conserved protein related to C-terminal domain of eukaryotic chaperone, SACSIN Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1834 hypothetical 1 Conserved hypothetical protein 1 single function Multicopy 04/22/01 00:00:00 terminal status:good S COG2250 Function unknown Uncharacterized ACR

CROSS REFERENCES:
pI: 5,05
MW: 15185,05
GenBank: 13815092